GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 16:55:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_055080245             255 bp    mRNA    linear   MAM 14-APR-2023
DEFINITION  PREDICTED: Physeter catodon non-histone chromosomal protein
            HMG-14-like (LOC102973125), mRNA.
ACCESSION   XM_055080245
VERSION     XM_055080245.1
DBLINK      BioProject: PRJNA434122
KEYWORDS    RefSeq.
SOURCE      Physeter catodon (sperm whale)
  ORGANISM  Physeter catodon
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
            Cetacea; Odontoceti; Physeteridae; Physeter.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041231.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_002837175.3-RS_2023_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/05/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..255
                     /organism="Physeter catodon"
                     /mol_type="mRNA"
                     /isolate="SW-GA"
                     /db_xref="taxon:9755"
                     /chromosome="18"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
     gene            1..255
                     /gene="LOC102973125"
                     /note="non-histone chromosomal protein HMG-14-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 20 Proteins"
                     /db_xref="GeneID:102973125"
     CDS             1..255
                     /gene="LOC102973125"
                     /codon_start=1
                     /product="non-histone chromosomal protein HMG-14-like"
                     /protein_id="XP_054936220.1"
                     /db_xref="GeneID:102973125"
                     /translation="
MPKKKVSSAEGAVKEEPKKRLARLSAKPAPAKVETKPKKAAGKDTSSDKKCKPKGKGGAKAKQAEMANQATKEDLPAENGETKN"
ORIGIN      
atgcccaagaagaaggtcagctccgctgagggggcagtgaaggaggagcccaagaagagattggcaaggttgtcagctaaaccggctcctgcaaaagtggaaacgaagccaaaaaaggcagcaggaaaggatacatcttcagacaaaaagtgcaaaccaaagggaaaagggggagcaaaggcaaaacaggctgaaatggctaaccaagcgactaaagaagacttacctgcagaaaatggagaaactaaaaactag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]