GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 09:50:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_034156758             300 bp    mRNA    linear   PLN 06-MAY-2020
DEFINITION  Diutina rugosa uncharacterized protein (DIURU_003940), partial
            mRNA.
ACCESSION   XM_034156758
VERSION     XM_034156758.1
DBLINK      BioProject: PRJNA629604
            BioSample: SAMN11490865
KEYWORDS    RefSeq.
SOURCE      Diutina rugosa
  ORGANISM  Diutina rugosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetales incertae
            sedis; Diutina.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Mixao,V., Saus,E., Hansen,A., Lass-Flor,C. and Gabaldon,T.
  TITLE     Genome assembly of two rare yeast pathogens: Diutina rugosa and
            Trichomonascus ciferrii
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAY-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Mixao,V., Saus,E., Hansen,A., Lass-Flor,C. and Gabaldon,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUL-2019) Bioinformatics, Centre for Genomic
            Regulation, Carrer Dr. Aiguader, 88, 5, Barcelona 08003, Spain
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_022995166).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Diutina rugosa"
                     /mol_type="mRNA"
                     /strain="CBS 613"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /culture_collection="CBS:613"
                     /type_material="type material of Mycoderma rugosum"
                     /db_xref="taxon:5481"
                     /chromosome="Unknown"
                     /country="USA"
     gene            <1..>300
                     /locus_tag="DIURU_003940"
                     /db_xref="GeneID:54782591"
     CDS             1..300
                     /locus_tag="DIURU_003940"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_034011263.1"
                     /db_xref="GeneID:54782591"
                     /translation="
MAKSGIAVGLNKGHKTTAKEVAPKISYRKGALTKRTEFVRSIVSEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALKKVEEMNGVIAASRKH"
     misc_feature    10..294
                     /locus_tag="DIURU_003940"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:426088"
ORIGIN      
atggctaagtctggtattgctgttggtctcaacaagggtcacaagactaccgctaaggaagtcgcccccaagatctcgtacagaaagggtgccctcaccaagagaaccgagttcgtcagatcgatcgtgtcggaagtcgccgggttggctccttacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagagatgaacggtgtcatcgctgcttccagaaagcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]