GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 23:39:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_029800585             609 bp    mRNA    linear   INV 08-OCT-2020
DEFINITION  PREDICTED: Octopus sinensis stress response protein NST1-like
            (LOC115230060), mRNA.
ACCESSION   XM_029800585
VERSION     XM_029800585.1
DBLINK      BioProject: PRJNA551489
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Octopus sinensis (East Asian common octopus)
  ORGANISM  Octopus sinensis
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca;
            Cephalopoda; Coleoidea; Octopodiformes; Octopoda; Incirrata;
            Octopodidae; Octopus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042997.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Octopus sinensis Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..609
                     /organism="Octopus sinensis"
                     /mol_type="mRNA"
                     /db_xref="taxon:2607531"
                     /linkage_group="LG1"
     gene            1..609
                     /gene="LOC115230060"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:115230060"
     CDS             1..609
                     /gene="LOC115230060"
                     /codon_start=1
                     /product="stress response protein NST1-like"
                     /protein_id="XP_029656445.1"
                     /db_xref="GeneID:115230060"
                     /translation="
MNRYDELVRRTDESVRRKDESVRSKDESVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDELVRRTDESVGRKDESVRSKDEPVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDESVRRKDESVQRKDESVRCKDESVQRKDELVRRKDESVRRKDESWNAGCGEYHAQLK"
     misc_feature    <46..573
                     /gene="LOC115230060"
                     /note="MAEBL; Provisional; Region: PTZ00121"
                     /db_xref="CDD:173412"
ORIGIN      
atgaatcggtacgatgaattagtacgacgcacagatgaatcggtacgacgtaaagatgaatcggtacgaagcaaagatgaatcggtacgacgcaaagatgaattagtacgacgcaaagatgaatcggtacgacgcaaagatgaattagtacgacgtaaagatgaatcggtacgacgcaaagatgaatcggtacgacgtaaagatgaattagtacgacgtaaagatgaattagtacgacgcacagatgaatcggtaggacgtaaagatgaatcggtacgaagcaaagatgaaccggtacgacgcaaagatgaattagtacgacgcaaagatgaatcggtacgacgcaaagatgaattagtacgacgtaaagatgaatcggtacgacgtaaagatgaatcggtacgacgcaaagatgaattagtacgacgcaaagatgaatctgtacgacgtaaagatgaatcggtacaacgtaaagatgaatcggtacgatgcaaagatgaatcggtacaacgtaaagatgaattagtacgacgtaaagatgaatcggtacgacgtaaagatgaatcatggaacgctggatgtggcgaatatcacgcacagttaaaatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]