GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 09:55:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_004177506             303 bp    mRNA    linear   PLN 15-JUN-2017
DEFINITION  Tetrapisispora blattae CBS 6284 hypothetical protein (TBLA0A02360),
            partial mRNA.
ACCESSION   XM_004177506
VERSION     XM_004177506.1
DBLINK      BioProject: PRJNA188088
            BioSample: SAMEA2271984
KEYWORDS    RefSeq.
SOURCE      Tetrapisispora blattae CBS 6284
  ORGANISM  Tetrapisispora blattae CBS 6284
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-2012) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_020185).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Tetrapisispora blattae CBS 6284"
                     /mol_type="mRNA"
                     /strain="type strain:CBS 6284"
                     /db_xref="taxon:1071380"
                     /chromosome="1"
     gene            <1..>303
                     /gene="TBLA0A02360"
                     /locus_tag="TBLA_0A02360"
                     /db_xref="GeneID:14492785"
     CDS             1..303
                     /gene="TBLA0A02360"
                     /locus_tag="TBLA_0A02360"
                     /inference="similar to DNA
                     sequence:INSDC:YMR194W,YPL249C-A"
                     /note="similar to Saccharomyces cerevisiae RPL36A
                     (YMR194W) and RPL36B (YPL249C-A); ancestral locus
                     Anc_6.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_004177554.1"
                     /db_xref="GeneID:14492785"
                     /db_xref="GOA:I2GV83"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:I2GV83"
                     /translation="
MAVKTGIAVGLNKGKQVVSMTPAAKISYKKGQSSQRTKFVRSLVREIAGLAPYERRLIDLIRNAGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
     misc_feature    13..297
                     /gene="TBLA0A02360"
                     /locus_tag="TBLA_0A02360"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:426088"
ORIGIN      
atggctgtcaaaactggtattgctgttggtttgaacaaaggtaagcaggtcgtctctatgaccccagctgccaagatctcatacaagaagggccaatcttctcaaagaaccaagttcgtcagatctttggtcagagaaatcgctggtttagctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggttgaagaaatgaacaacatcattgctgcctctcgtcgtcattag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]