GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 14:36:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001093287             894 bp    mRNA    linear   VRT 29-OCT-2016
DEFINITION  Xenopus laevis claudin 6, gene 1 L homeolog (cldn6.1.L), mRNA.
ACCESSION   NM_001093287
VERSION     NM_001093287.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 894)
  AUTHORS   Sun J, Wang X, Li C and Mao B.
  TITLE     Xenopus Claudin-6 is required for embryonic pronephros
            morphogenesis and terminal differentiation
  JOURNAL   Biochem. Biophys. Res. Commun. 462 (3), 178-183 (2015)
   PUBMED   25979361
  REMARK    GeneRIF: claudin-6 is expressed in the developing pronephric tubule
            and duct but not glomus. Knockdown of claudin-6 by specific
            morpholino led to severe defects in pronephros tubular
            morphogenesis and blocked the terminal differentiation of the
            tubule cells.
REFERENCE   2  (bases 1 to 894)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
REFERENCE   3  (bases 1 to 894)
  AUTHORS   Gawantka V, Pollet N, Delius H, Vingron M, Pfister R, Nitsch R,
            Blumenstock C and Niehrs C.
  TITLE     Gene expression screening in Xenopus identifies molecular pathways,
            predicts gene function and provides a global view of embryonic
            patterning
  JOURNAL   Mech. Dev. 77 (2), 95-141 (1998)
   PUBMED   9831640
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC077402.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC077402.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00012418, SAMD00012420
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-894               BC077402.1         25-918
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="9_10L"
     gene            1..894
                     /gene="cldn6.1.L"
                     /gene_synonym="cldn4l2; cldn6; cldn6.1"
                     /note="claudin 6, gene 1 L homeolog"
                     /db_xref="GeneID:446591"
                     /db_xref="Xenbase:XB-GENE-959189"
     misc_feature    39..41
                     /gene="cldn6.1.L"
                     /gene_synonym="cldn4l2; cldn6; cldn6.1"
                     /note="upstream in-frame stop codon"
     CDS             45..689
                     /gene="cldn6.1.L"
                     /gene_synonym="cldn4l2; cldn6; cldn6.1"
                     /codon_start=1
                     /product="claudin 6, gene 1 L homeolog"
                     /protein_id="NP_001086756.1"
                     /db_xref="GeneID:446591"
                     /db_xref="Xenbase:XB-GENE-959189"
                     /translation="
MASTGLQILGMALALIGWVGCIITCAMPMWRVTAFIGNNIVVAQTIWEGLWMNCIVQITGQMQCKVYDSMLALSQDLQAARALTVICILVALLALLIGVVGAKCTNCIEDENTKAKVSMVSGVVYLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSTLMLLGGGLLCCSCPKKEDNHYSARYTAAASQPRSDYPSKDYV"
     misc_feature    54..554
                     /gene="cldn6.1.L"
                     /gene_synonym="cldn4l2; cldn6; cldn6.1"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
ggtttctgctgcagctttcttcaccttgacaactcctgtaaaagatggcttctactggtctccagatccttggcatggcccttgccctcattggctgggtgggatgtataatcacctgtgccatgcccatgtggagggtgactgccttcattgggaacaacatagtggtggctcaaaccatctgggaaggactgtggatgaattgcattgtgcagattactggacagatgcagtgcaaggtctatgactccatgttggctctctcccaggatttgcaggctgcccgtgcccttactgtcatctgtatactggtagccctgctggccttgctcattggtgttgtgggagccaagtgcaccaactgcatagaagatgagaacaccaaggccaaagtcagcatggtatccggcgtggtctacctggtggccggtatcctcatgctcatccctgtctgctggtctgcaaacagcatcatccgtgacttctacaatcccctggtggtggaggctcagaagagagaactgggagctgccatatacatagggtgggcttcctctacactgatgctcctgggtggaggcctcctgtgctgctcttgccccaagaaggaagataaccactactctgccagatacactgctgctgcttcccagccacgaagtgactatcccagcaaggattatgtctgaggacacgactagataatcatggacattttttcctgtattaatgttgggggttctccagcaagggcacttgaactgaaggggtgttggcttctggaggctatttttgtgacttttaggctttttatagcatgcaatgatttaataaaatggatgtttgttttgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]